PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV51106.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family WOX
Protein Properties Length: 292aa    MW: 31986.7 Da    PI: 6.417
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV51106.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.36.3e-093402457
                S--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox 24 ypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +p ++e++++  +l    ++ +++V++WFqNr+ + k+
  KZV51106.1  3 NPPRDEIRKIRVQLqeygHVGDANVFYWFQNRKSRSKH 40
                7999*******************************995 PP

2Wus_type_Homeobox66.64.7e-221422465
  Wus_type_Homeobox 24 lrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++P+++ei++i+ +L+eyG+++d+NVfyWFQNrk+R+++kq
         KZV51106.1  1 MVNPPRDEIRKIRVQLQEYGHVGDANVFYWFQNRKSRSKHKQ 42
                       78**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.28E-6346IPR009057Homeodomain-like
PfamPF000462.2E-6340IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.5E-4846IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MVNPPRDEIR KIRVQLQEYG HVGDANVFYW FQNRKSRSKH KQRQQQNISK SKQQNAPSPT  60
TSPNVASQIP ISSSSYSDKS APNDSAEKAL SVCSSTVNID MINSSPTASV NQSFLPTSNE  120
FLAEPFFFPV HPNSAGGPSA ASAAALASGF FSSDISRDHH GSSFPVSELM LMNNDYLKKA  180
EEINLQQLLC DSAAKAPVNA GDAIFTPSLA VPFPNHVNLH EGDREMGPTK STVFINDVCF  240
EVGSDPFNVR QAFGDDAVLL QSSGQPVLTN EWGITLQPLS HGHFYYLLRL IW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086022.19e-96PREDICTED: WUSCHEL-related homeobox 8-like
TrEMBLA0A068TN052e-75A0A068TN05_COFCA; Uncharacterized protein
STRINGPOPTR_0004s05090.16e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59422335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.13e-17WUSCHEL related homeobox 8